PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01052.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 319aa    MW: 35964.8 Da    PI: 6.8459
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01052.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+lv +++ +G+g W+t ++  g++R++k+c++rw +yl
  Rsa1.0_01052.1_g00001.1 14 KGPWTPEEDEKLVSYIHAHGPGKWRTLPKNAGLRRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding52.79.6e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg ++ +E+e +++++++lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_01052.1_g00001.1  67 RGEFSLQEEETIIQLHRLLGNK-WSAIAIHLP-GRTDNEIKNYWNTH 111
                              899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-25764IPR009057Homeodomain-like
PROSITE profilePS5129419.426961IPR017930Myb domain
SuperFamilySSF466896.74E-3012108IPR009057Homeodomain-like
SMARTSM007176.3E-151363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001671.18E-111661No hitNo description
PROSITE profilePS5129425.8462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2665116IPR009057Homeodomain-like
SMARTSM007174.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001671.24E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGKSSSSEES EVKKGPWTPE EDEKLVSYIH AHGPGKWRTL PKNAGLRRCG KSCRLRWTNY  60
LRPDIKRGEF SLQEEETIIQ LHRLLGNKWS AIAIHLPGRT DNEIKNYWNT HIKKKLLRMG  120
IDPVTHCPRI NLLQLSSFLT SSLFKSMSQP MNIPFDLANS SINPELLNQL NTSLSNVQTE  180
SYQHHQPNQQ LQNDHQTSFT GLLNSTPPVQ WQNNGEYLDN YLNYTGSGDQ SINQVPQTGS  240
YSSAAFTSDE IYDGEKFKAG WNFSSSMLPG TSSSSSTPLN SSSTVFINGG SEDDKESYGS  300
DMLMFHRHHD HDNNALNLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-29111161105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00563DAPTransfer from AT5G54230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866030.10.0hypothetical protein ARALYDRAFT_357679
RefseqXP_002866031.10.0hypothetical protein ARALYDRAFT_331771
TrEMBLD7MU680.0D7MU68_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_80014660.0(Arabidopsis lyrata)
STRINGfgenesh1_pm.C_scaffold_80011140.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144651722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G54230.11e-163myb domain protein 49